General Information

  • ID:  hor005804
  • Uniprot ID:  P35905
  • Protein name:  Fucilin gene-related peptide 8
  • Gene name:  NA
  • Organism:  Lissachatina fulica (Giant African land snail) (Achatina fulica)
  • Family:  NA
  • Source:  animal
  • Expression:  Found in central ganglia and the ventricles and atria of the heart.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lissachatina (genus), Achatinidae (family), Achatinoidea (superfamily), Helicina, Stylommatophora (order), Eupulmonata (superorder), Panpulmonata, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  SPYDFV
  • Length:  6
  • Propeptide:  MQPTVLLILMTSCLTYQVIADKPKGNHLHSRPERSPIVLFSDAPHAAASPADENDNFPVLKTANQYEDNNSATFSHLEEKHDFAEKQSTGDDEESVILNRVTGEVLSDTVDGSQGHLEPKRFNEFVGKRNTLPEEAGSFDADSQPGSLDTVRILAGLSNFGQPQIIDQGNMKNHRTLKNMIHNLYNTMNEDEASKRQYEFVGKRSYDFVGKRTYDFLGKRSPYYFLGKRYDFIGKRSPYDFIGKKNYDFVGKRSPYDFVGKRNQGVFTVSPSSTKISFDDNYLPYLSSVDAGDLSDVNKRYAEFLGKRKRTAEQDETSQRSNERLVALLQNTGFRKRLSRMLQNQRLVEHYPEFIGK
  • Signal peptide:  MQPTVLLILMTSCLTYQ
  • Modification:  T6 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Potentiates tetanic contraction of the penis retractor muscle at very low concentrations, and also shows modulatory actions on the activity of the buccal and ventricular muscles and the central ganglionic neurons.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P35905-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005804_AF2.pdbhor005804_ESM.pdb

Physical Information

Mass: 81614 Formula: C35H46N6O11
Absent amino acids: ACEGHIKLMNQRTW Common amino acids: DFPSVY
pI: 3.75 Basic residues: 0
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: -3.33 Boman Index: -524
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 48.33
Instability Index: 10846.67 Extinction Coefficient cystines: 1490
Absorbance 280nm: 298

Literature

  • PubMed ID:  7722509
  • Title:  A novel cDNA sequence encoding the precursor of the D-amino acid-containing neuropeptide fulicin and multiple alpha-amidated neuropeptides from Achatina fulica.
  • PubMed ID:  1859408
  • Title:  Fulicin, a novel neuropeptide containing a D-amino acid residue isolated from the ganglia of Achatina fulica.